SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4JKR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4JKR5
Domain Number 1 Region: 9-125
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.25e-33
Family Calponin-homology domain, CH-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4JKR5
Sequence length 149
Comment (tr|B4JKR5|B4JKR5_DROGR) GH12721 {ECO:0000313|EMBL:EDW00168.1} KW=Complete proteome; Reference proteome OX=7222 OS=Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi). GN=Dgri_GH12721 OC=Ephydroidea; Drosophilidae; Drosophila; Hawaiian Drosophila.
Sequence
MGNEYRIAKNVVLTRNSKEQFSKIKILNWVNETLESNLSRIKDLCTGAAYCNLMDILFPN
LIQMRNVKFMGNQKIDYIKNFKLLQQGFNKLQVNVSFDIQELIKGNYRENYQFANWFKVF
YDRNFESICKNYCAKKARGYQEIGMAISN
Download sequence
Identical sequences B4JKR5
7222.FBpp0146627 FBpp0146627 XP_001991543.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]