SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4K243 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4K243
Domain Number 1 Region: 47-135
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000471
Family Insect pheromone/odorant-binding proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4K243
Sequence length 205
Comment (tr|B4K243|B4K243_DROGR) GH24483 {ECO:0000313|EMBL:EDW04510.1} KW=Complete proteome; Reference proteome OX=7222 OS=Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi). GN=Dgri_GH24483 OC=Ephydroidea; Drosophilidae; Drosophila; Hawaiian Drosophila.
Sequence
MNVLIVTGFTILIQLLLGQQSVGIRVHCRHVERIHENHIHLCCKHPDGHNNVTEMCAKQT
NFKLPSKDEEAIEDLTVDQVMPGSCWADCVFEHYKFMVNGSLDMEAVRSHYRTFHKQDPE
YETEMLIAFERCHLKQEEGTPEFLSLNAVRAFSSSKYCKPKASIILSCVIKNFFHNCPSS
RWSNTDECLETLAFAKKCKDVLTTM
Download sequence
Identical sequences B4K243
XP_001997347.1.65300 7222.FBpp0158389 FBpp0158389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]