SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4K602 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4K602
Domain Number 1 Region: 31-148
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 5.1e-30
Family Insect pheromone/odorant-binding proteins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4K602
Sequence length 154
Comment (tr|B4K602|B4K602_DROMO) Odorant-binding protein 99b {ECO:0000313|EMBL:EDW16239.1} KW=Complete proteome; Reference proteome OX=7230 OS=Drosophila mojavensis (Fruit fly). GN=Dmoj_GI22335 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MKLFILLLSLTLAFADHHEGHSHDHDHGSGYVVKTHEDLVRFRNICAEQVHASAEDVAKY
VKWDFADEEKSRCYLKCIFEHFGLFDATHGFDVHKIHEQLAGGSHVDHADEVHQKIADCA
DNNAQGSDACTWAYRGGMCFMRSNLQLVQQSVKA
Download sequence
Identical sequences B4K602
XP_002000778.1.58863 XP_017866839.1.65068 FBpp0171552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]