SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4K6F5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4K6F5
Domain Number 1 Region: 350-636
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.47e-44
Family Eukaryotic proteases 0.0013
Further Details:      
 
Domain Number 2 Region: 26-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 162-205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 70-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 5 Region: 252-288
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000292
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 6 Region: 124-155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000288
Family LDL receptor-like module 0.0025
Further Details:      
 
Weak hits

Sequence:  B4K6F5
Domain Number - Region: 310-367
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00025
Family Complement control module/SCR domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4K6F5
Sequence length 643
Comment (tr|B4K6F5|B4K6F5_DROMO) Uncharacterized protein, isoform A {ECO:0000313|EMBL:EDW15228.1} KW=Complete proteome; Reference proteome OX=7230 OS=Drosophila mojavensis (Fruit fly). GN=Dmoj_GI24709 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MISKHLKSHLLCICVTLLSFSARSVYGACGAIQFECDNGSCISKFEVCDGTKNCPDGSDE
TGLICVSQRNQCTKPYFTCSYGACVIGTAPCNGIIECADGSDETVFLCGTSDVKRQIESN
LKGNCKDEEFKCPSGICLEKSTYLCNGYDDCGDGTGYDESVNYCGHIECPGYAFKCASGG
CIAGDLICNGKADCFDNSDEAPLLCNTSSVTTQPTVVLPTSLSGCPLPHGDELPILKDKY
GTYLKPPINMITVFFSCKPGYVLEGAKASRCANQQWSLDVVPTCVKYCDTWQDSEGRPKN
LLHGYSTNPTCTYEGQAVNCSARYHPPGTEVTFICATGFRSSNILPQPPMKCMAGGYWSR
QRVPCAQECGQIATPITQFSANGYSINNTVVPWHVGIYVGHNEKDYNFVCGGSLLTPDLV
ITAAHCVYSEVSKNAYNANTFRVVAAKLYRGYNNVTNEDRRREVESIIVAPKYKGREDNY
KNDIALIFLSDPYKLSNVVRPVCLEFFDFSEKENINNDVQGQFAGWNFKDERELQFVPAK
SQMNSVCQASLYDISSDKFCMYTQGTSLACHGDSGGGFTARREMLGDVRLTFSRDRFRHY
LYGVISSAPSAGQCAESLTTLTNIQHFADLIRTAMQKSLDVNA
Download sequence
Identical sequences B4K6F5
XP_001999767.1.58863 FBpp0173926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]