SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4KC20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4KC20
Domain Number 1 Region: 25-280
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.79e-46
Family Proline iminopeptidase-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4KC20
Sequence length 283
Comment (tr|B4KC20|B4KC20_DROMO) Uncharacterized protein {ECO:0000313|EMBL:EDW16893.1} KW=Complete proteome; Reference proteome OX=7230 OS=Drosophila mojavensis (Fruit fly). GN=Dmoj_GI10790 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MIVGTRLSRLAAGRLLPGMASRCAHTERKVQVPDTGDLHIVESGSGSRSLLLMPGALGSA
WTDFKPQIEQLPKLLPDHTIIAWDPPGYGKSVPPQRKFGLEFFREDAEAAVKLMRALNRP
KFSVLGWSDGGITALILAGRHADAVEKLAIWGAGAYLNKDEVQSLQAIRDVAKWSPRMRE
PMEKVYGVERFAQLWGEWVDAACEFYKQRDGDFCRSEVEQVKAPVFILHGKKDPMIAPEH
VPWLKQRLPNALYHEFPDGKHNIHLRYAEEFNKLVADFFRGKE
Download sequence
Identical sequences B4KC20
XP_002001432.1.58863 FBpp0160007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]