SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4L070 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4L070
Domain Number 1 Region: 27-134
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 3.01e-31
Family Insect pheromone/odorant-binding proteins 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4L070
Sequence length 147
Comment (tr|B4L070|B4L070_DROMO) Odorant-binding protein 69a {ECO:0000313|EMBL:EDW18016.1} KW=Complete proteome; Reference proteome OX=7230 OS=Drosophila mojavensis (Fruit fly). GN=Dmoj_GI13005 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MYSKTLSVTLALLVLCCEITPHQAFDVPEVVKKHVKKLHKRCVAKTGVSEELLEHAQKGN
LPNDPTFKCFLHCMFDMFGLIDSDNVMHLEALVEVLPVEIHDKILALVDACGKKKGVDGC
DTAYQSVECYMATDAPFMLSGITEILG
Download sequence
Identical sequences B4L070
FBpp0162222 XP_002007540.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]