SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4L659 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4L659
Domain Number 1 Region: 56-166
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000209
Family Insect pheromone/odorant-binding proteins 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4L659
Sequence length 177
Comment (tr|B4L659|B4L659_DROMO) Odorant-binding protein 19c {ECO:0000313|EMBL:EDW05855.1} KW=Complete proteome; Reference proteome OX=7230 OS=Drosophila mojavensis (Fruit fly). GN=Dmoj_GI16240 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MHSTLLSLLALASGIWVQCSMAEPQIKGQQLPQFDLTRLFGGRSSVPLVTLLDRNLPEVQ
QMIDRTKKSCLQKLRMPAVQRSLIREPNPTEQEKCLLECVLKGIQIMDDSTNKLNLRRVE
QLTSLVTEDNKVAMALSSSLAQSCNRSVSTQKPCEAAHQLNQCIGRQMERNRVKLHW
Download sequence
Identical sequences B4L659
XP_002011013.1.58863 FBpp0165457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]