SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4L7D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4L7D2
Domain Number 1 Region: 72-523
Classification Level Classification E-value
Superfamily Sema domain 1.83e-131
Family Sema domain 0.0000478
Further Details:      
 
Domain Number 2 Region: 1393-1522,1731-1892
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.02e-44
Family p120GAP domain-like 0.047
Further Details:      
 
Domain Number 3 Region: 885-979
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000126
Family Other IPT/TIG domains 0.009
Further Details:      
 
Domain Number 4 Region: 978-1066
Classification Level Classification E-value
Superfamily E set domains 0.00000000000154
Family Other IPT/TIG domains 0.062
Further Details:      
 
Domain Number 5 Region: 526-577
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000196
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 1085-1167
Classification Level Classification E-value
Superfamily E set domains 0.000000021
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4L7D2
Sequence length 1949
Comment (tr|B4L7D2|B4L7D2_DROMO) Uncharacterized protein, isoform B {ECO:0000313|EMBL:KRG07293.1} KW=Complete proteome; Reference proteome OX=7230 OS=Drosophila mojavensis (Fruit fly). GN=Dmoj_GI14102 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MNILICCVLSITIFETSSASASSSLGNGLTSWIQREDRIKRRASALKINLTETDMNVGYL
NSSSSSVITHVARFDTTLNHLLVDTITGRVFVGGVNRLYQLSPDLELHETVKTGPQNDSV
ECTILDCPLNAIRKPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIIEHEVPD
AVVANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKSKMFQI
ASSAVTTGTRTFINSYARENYLVNYVYGFSSERFSYFLTTQLKHSHHSSPKEYITKLVRI
CQEDSNYYSYTEIPVECISEAQGGIKFNLVQAGFLGKPSLDLAQSLGISIQDDVLFAVFS
KGESNIPTNSSALCIYSLKSIRRKFMQNIKFCFNGNGMRGLDFISPSMPCVLTKLQTIGE
DFCGLDVNSPLGGEQPITAVPVAMFNTLLTSVAATSTSGYTVVFIGTVDGYIKKVVVESS
TIANEYASLAVDVGSPIKQDMQFDNQNLYVYAMSDRKVSKVKVYDCADFRTCGECLGARD
PYCGWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIID
HLPQLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTR
NGPDLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRI
GPSYRSGPGFCPTINATGDGSEVLVAAGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVT
SLNAQLLGDTIYCDNMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCRDMADS
CGICLALAEKYNCGWCSSTNTCEVVEQCNKNNEGKTDWLNRSEICPNPEIHSFEPKTGPW
EGGTNITIKGINLGKNYNDIYSGVRIAGINCMPFQQFYIDTKQIVCTVDSPGEQMYRNGR
IVVQIGDYRGESKEDYEFVDPKISNFYPRFGPTSGGTQIRIIGKHLNAGSRIQAYINDHL
PCKIISTDSSQAICRTSPSPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEHVSSGPSA
QIKIPKGIPAGGIRIVVTGTQFTSIQAPSIYVLYNGQMYASQCRVHSDTEMKCPSPVIEA
DSQTLDPDNPTLLEYGFLMDNVLKVQNLSKKHNNHFELYPNPEYFAFEERVKYFKSEYLT
INGRNLDRACKETDVEVKIGNGFCNITSLSRQQLTCRPPTEASAASNSPSGPEVIVRIGS
SLEYRIGILSYESSNLIMDWGDNVVFVVIAGCVIFLLIFVALLVAYRKKTSESNRVLRNM
QEQMDILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHNV
LQWEKPELLRKEKGLRLFAQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSK
LEYCTDILKTLLSDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEP
LYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRAMTVNASIIQQPIFCNNLD
MLPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILY
DEDATSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNIS
KYTSSSPTFSRAGSPLNNDMHDNGIKYWHLVKHHDSDIQKEGERVNKLVSEIYLTRLLAT
KGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQALLHGITDPEVVHTWKSNSLP
LRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDI
PEYRKWVDRYYRDIRDMSSISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQL
TVTLEEDEFSQKQRLAFKLEQVHNIMSAE
Download sequence
Identical sequences B4L7D2
XP_002011436.2.58863 XP_015016234.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]