SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4LB63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4LB63
Domain Number 1 Region: 113-233
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.54e-33
Family cAMP-binding domain 0.00000202
Further Details:      
 
Domain Number 2 Region: 243-365
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.93e-30
Family cAMP-binding domain 0.00000218
Further Details:      
 
Domain Number 3 Region: 13-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 3.01e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4LB63
Sequence length 376
Comment (tr|B4LB63|B4LB63_DROVI) Uncharacterized protein, isoform A {ECO:0000313|EMBL:EDW68627.1} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=Dvir_GJ12814 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MSYMMAKTLEEQSLRECEHYIQSHGIQRVLKDCIVQLCVCRPDNPVQFLRNYFQKLEREQ
VKLDASKQVISPDDCEDLSPMPQTAAPPVRRRGGISAEPVTEEDAANYVKKVVPKDYKTM
NALSKAIAKNVLFAHLDESERSDIFDAMFPVTHTAGENIIQQGDEGDNFYVIDVGEVDVF
VNSELVTTISEGGSFGELALIYGTPRAATVRAKSDVKLWGIDRDSYRRILMGSTIRKRKM
YEEFLSRVSILESLDKWERLTVADSLETCSFEDGETIVKQGAAGDDFYIILEGCAVVLQQ
RSEGEEPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADI
LKRNITQYNSFVSLSV
Download sequence
Identical sequences B4LB63
FBpp0227231 XP_002046285.1.90633 7244.FBpp0227231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]