SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4LHU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4LHU8
Domain Number 1 Region: 442-495
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000144
Family Tachycitin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4LHU8
Sequence length 497
Comment (tr|B4LHU8|B4LHU8_DROVI) Uncharacterized protein {ECO:0000313|EMBL:EDW70673.1} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=Dvir_GJ11408 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MRNLYALTLLLIAVSASSILGANLDSRQYVPLSVSARDAGTPCLTTTPPCVNTRPPCSGN
AQPTTTTPSVTTKPPCTEEEDKTTTTPCSTTTTTTTTTTTTTTKTTTPTTTTTTTTTTKT
TTTTTTTTTTTTSTTTTKTTTTATTTCSTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTKP
TTTTTTTCSTTTTTTTTTTTTTTTTTTTTTTKTTTTTTTTCSTTTTTTTTTTTTTTTTTT
TTCSTTTTTTTTTTTTTTTTTTTTTTTTTTCSTTTSTTTTTTTTTTTTTCSTTTSTTTTT
TTTTTTTTTTTTTTTTTTTCSTTTSTTTTTTTTTTCSTTTSTTTTTKTTTTTTTTTTCST
TTTTTECITTTPKTTTCSTTITVTTDCNTTTPPCTTTTKCPGGAAATKAKQPFRARPSFR
PLKEVTQLMNGVSSTDDQIQFICVGKPNGFLLASPTRCNDYYICRHQQPLKVSCGDKYFN
GQKGICDLPENTGCVQH
Download sequence
Identical sequences B4LHU8
XP_002048331.1.90633 FBpp0225825 7244.FBpp0225825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]