SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4LJ55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4LJ55
Domain Number 1 Region: 94-165
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.71e-19
Family Pointed domain 0.0000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4LJ55
Sequence length 172
Comment (tr|B4LJ55|B4LJ55_DROVI) Uncharacterized protein {ECO:0000313|EMBL:EDW61491.1} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=Dvir_GJ22079 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MQVEASYPKYAGRVPPLDLSQVNAGQEQLQQLWASNAAAAMKRHHPYQMLDKCRGGVTVL
SEDINNNNSIATGNSQHNNMNNNTSLHHPIGSDGLPVDPRDWTRADVWKWLISMAVSEGL
EVTPELPQKFPMNGKALCLMSLDMYLCRVPVGGKMLYRDFRVRLARAMALLS
Download sequence
Identical sequences B4LJ55
7244.FBpp0236496 FBpp0236496 XP_002050298.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]