SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4LN92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4LN92
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 1.96e-38
Family MIR domain 0.0031
Further Details:      
 
Domain Number 2 Region: 1083-1212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-21
Family SPRY domain 0.026
Further Details:      
 
Domain Number 3 Region: 665-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000348
Family SPRY domain 0.057
Further Details:      
 
Domain Number 4 Region: 98-182
Classification Level Classification E-value
Superfamily MIR domain 0.000000209
Family MIR domain 0.025
Further Details:      
 
Domain Number 5 Region: 2251-2349
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000275
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 6 Region: 4208-4270
Classification Level Classification E-value
Superfamily EF-hand 0.0000342
Family Calmodulin-like 0.032
Further Details:      
 
Weak hits

Sequence:  B4LN92
Domain Number - Region: 449-630
Classification Level Classification E-value
Superfamily ARM repeat 0.0115
Family GUN4-associated domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4LN92
Sequence length 5131
Comment (tr|B4LN92|B4LN92_DROVI) Uncharacterized protein, isoform A {ECO:0000313|EMBL:EDW60096.1} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=Dvir_GJ21297 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MAEAEGGSEQDDVSFLRTEDMVTLSCTATGERVCLAAEGFGNRHCFLENIADKNVPPDLS
QCVFVIEQALSVRALQELVTAAGSETGKGTGSGHRTLLYGNAILLRHHNSDMYLACLSTS
SSNDKLSFDVGLQEHSQGEACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKE
NEQSIVNASFHVTHWSVQPYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWGREAG
QNIVIYEGGVVMAQARSLWRLELARTKWTGGFINWYHPMRIRHITTGRYLGVNDSNELIL
VKKEEASIATTTFCLRQEKDDEKKVLEDKDLEIIGSPIIKYGDTTVIVQHCESSLWLSYK
SYETKKKGVGKVEEKQAILHEEGKMDDCLDFSRSQEEESKTARVIRKCSSLFTQFITALE
TLQSNRRHSVFFQKVNLNEMVMCLEDLINYFSQPEDDMEHEEKQNRFRALRNRQDLFQEE
GVLNLILEAIDKINIITSQGFLASFLAGDETGQSWDLISTYLYQLLAAIIKGNHTNCAQF
ANSNRLNWLFSRLGSQASSEGSGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRD
PKVLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTLLVDHVASIRPNIFVGRVDGS
SMYQKWYFEVTMDHIEQTTHIMPHLRIGWANTSGYVPYPGGGKKWGGNGVGDDLYSFGFD
GAHLWTGGRKSLVVDALPEEPFIRKGDVIGVAIDLSVPVITFTFNGAKVRGCFRDFNLDG
MFFPVMSCSSKLSCRFLFGGDHGRLKYAPPMGFSALVQCLMPHQILSLDPCFYFGNLSKN
VLAGPWLIEDDTPFVPKPVDTTGVSLPSSVDQIKEKLAENIHEMWALNKIDAGWTWGEHR
DDYHRIHPCLTQFEKLPAAEKRYDNQLAVQTLKTIISLGYYITMDKPPARIRPVRLPNEI
FMQANGYKPAPLDLSAVTLTPKLEELVDQLAENTHNLWARERIQQGWTYGLNEDSENHRS
PHLVPYAKVDEAIKKANRDTASETVRTLLVYGYVLDPPTGEGTEALLAEAQRLKFAAFRT
YRVERNYAVTSGKWYFEFEVLTAGPMRVGWARADCYPGAMLGSEDTSWAFDGHNVTKMHA
GTIEHFGVRYEAGDVIGCFIDVKEQTISFSLNGELLMDALGGETTFADVTAEGVGFVPAC
TLGVGQKARLIYGQDVDSLKFFTTCGLQEGYEPFCVNMRRPVTHWYTKDQPIFENTEEMP
DCRIDVTRIPGGADTPPHLKISHNTFETMEKANWEFLRLSLPVTCMSDFISEQEKARRWE
EIKIRQYRLMREAQEAAAQMQTQTVAHMDHMLKGGFNMNDIKGLTRNFDDHAEAEAEHMM
RVPSRPSRKGSLTRNITFESDMTAALDEMQRSSSVLDINGLGDDLDDKKKRGRSPFKFFS
KKSRDQSREKNGARTADASLERRNTVAHGRNVVNQQMTTRTPTLRLNNAEIPPSPVPQGP
KQLSSSNLGQPPVESSGNEMFDAECLKLINEYFYGVRIFPGQDPTHVYVGWVTTQYHLHS
REFNKSKVRRGSVYIEDYYEVPIERIDRQSCYVVRADELFNEVTQDASGKGASQGMFVGC
FVDTATGIIRFTCEGKDTSHRWMMEPDTKLFPAIFVEATSKEILQIELGRTPTTLPLSAA
VLPTSDKHINPQSPPRLKVQCLRPHQWARVPNTSLQVHALKLSDIRGWSMLCEDPISMLA
LHIPEEDRCIDILELIEMDKLLSFHAHTLTLYAALCYQSNYRAAHALCQHVDQKQLLYAI
RSEYMSGPLRQGFYDLLIALHLESHATTMEVCKNEYITPLGVELKELYAEDEMRHSLRSL
VTESVRPQLRMTEITPPVIATSIMPSVSSEPIPNIDQLYSPKFPLEVVREFVMEALKDAV
EINQVHNRDPIGWTNENLFLPLIKLTDRLLLVGVLTDEDVQKLLVMVDPETWDATFEKEG
KDEHRKGLLTMKMAEGAKLQMCYLLHHLYDTQLRHRVESIIAFSHDFVGDLQTDQLRRYI
EIKQSDLPSAVAAKKTKEFRCPPREQMNQILCFKNLEVDDQDNCTCGLELRSRLSEFHDC
LMQKVSLNALQEPDGTESNAIEEIKTGPITKIYNFINTVKELEEGPKEVEEPEKKTPEEI
FRKVLIKTIVSWAEESQIENPKLVREMFSLLVRQYDTVGELVRALEKTYVINNRARDDVA
EMWVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNATFFQHPDLIRILRVHENVMAVMMN
TLGRRAQAQSDAPTQTEGAEGVPSKEKDTSHEMVVACCRFLCYFCRTGRQNQKAMFDHFD
FLLDNANILLARPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAVYLSRCGLQSNSE
LVEKGYPDLGWDPVEGERYLDFLRYCVWVNGESVEENANLVIRLLIRRPECLGPALRGEG
EGLFRAIVEANRMSERISDRCKMQDEAEGTIAGLNFTHPLPEGDEDEDYIDTGAAILNFY
CTLVDLLGRCAPDVSVIEQGKNESLRARAILRSLVPLEDLQGVLSLKFTLTQTAPGEERP
KSDMPSGLLPNNKQSIVLFLERVYGIETQDLFYRLLEDAFLPDLRTATILDKSDGSESDM
ALAMNRYIGNSILPLLIKHSKFYNEAENYASLLDATLHTVYRLSKNRMLTKGQREAVSDF
LVALTSQMQPAMLLKLLRKLTVDVSKLSEYTTVALRLLTLHFDRCAKYYGSTQGQGSYGA
SSDEEKRLTMLLFSNIFDSLSNMDYDPELFGKALPCLIAIGCALPPDYSLSKNTDEDYYG
RQMGAPDQPQYVPNPIDTNNVHLDNDLNSLVQKFSEHYHDAWASRRLEGGWTYGEVRSDN
DRKHPRLKPYNMLSEYERERYRDPVRECLKGLLAIGWTVEHSEMDLPLNHRGSTRRQSKP
TIHDFQNEGSPFNYNPHPVDMSNLTLSREMQNMAERLAENSHDIWAKKKNEELDGCGGVI
HPQLVPYDLLTDKEKKKDRERSQEFLKYMQYQGYKLHKPSKGGAVEEGGATQAAVELRFS
YSLLEKLIQYLDRATINMKLLKPSTTFSRRTSFKTASRDIKFFSKVVLPLMEKYFSTHRN
YFIAIATATNNIGAASLKEKEMVASIFCKLAALLRNRLSAFGPDVRITVRCLQVLVKGID
AKTLTKNCPEFIRTSMLTFFNQTSDDLGNTIMNLQDGKYSHLRGTHLKTSTSLGYVNQVV
LPVLTAMFDHLAACDYGSDLLLDEIQVASYKILAALYHLGTDATLTHDRKYLKTEIERHR
PALGSCLGAYSSCFPVAYLEPHLNKHNQYSLLNRIADHSLEAQDIMVKMESCMPNLEAIL
SEVDQFVESDKTYNDAPHIIDVILPLLCAYLPFWWSQGPDNVSPTSGNHVTMVTADHMNS
LLRNVLKMIKKNIGNDNAPWMTRIAAYTQQIIINTSEELLKDPFLPLAERVKKRTENMLH
KEESMRGFIKSATDDTSQVETQLQEDWNLLVRDIYSFYPLLIKYVDLQRNHWLKDNIPEA
EELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMALIMPTATRRSAISEGVPAVGGKV
KKKKKNRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDRYLKKMPEYD
VIEFARNQLTLPDKLDPSDEMSWQHYLYSKLGKTEETVDEQALEKVNTNSNEKGKDKTTE
TVDRIVAMAKVLFGLHMIDHPQQQSKNVYRSVVSIQRKRAVIACFRQTSLHSLPRHRACN
IFARTYYEQWLQEENVGQEVMIEDLTQTFEESEKSKKDEEEADGKPDPLTQLVTTFCRGA
MTERSGALQEDLLYMSYAQIAAKSCGEEEEEGGEDGEAGEGGEEGEGTSIHEQEMEKQKL
LFHQARLSNRGVAEMVLLHISASKGIPSEMVMTTLNLGIAILRGGNIDIQMGMLNHLKEK
KDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGSEGAAGEKNMHDAEFTCALFRFIQ
LTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEIIDPAGKA
NFFKAIGVASQVFNTLTEVIQGPCTLNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQ
VDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESAGNVELILKYFDMFLKLA
DLIESPSFHEIDMKNEGWVIPKDFREKMEQSKNYTPEEMDFLLACCERNHEGKIDYRAFV
ERFHEPSKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIEILGSSKR
IERVYFEIKDSNIEQWEKPQIRESKRAFFYSIVTEGGDKEKLEAFVNFCEDAIFEMTHAS
GLMATDDGGSNVKRDTAYSSYMSEEEEERAARDPIRRTITAVKEGLKFGVHMLSPSNIKH
QIGVMQTKSIPELIVGFFKIIFYMFYYTGYAHYCVVRYIFGILLNLMRGPAPEQEEEEAV
VEEETFGRALPPLPLEEPPGTVQAFGLDINKEENGMYKVVVHESPAGSSVEEGGESSPED
GAAATAEFIEGEPYQEPISIVDLLGGEAAKKAAQERQEAQKAQEAAMASIEAEAKKSSAA
PQETPAVHQIDFSQYTHRAVSFLARNFYNLKYVALVLAFSINFMLLFYKVTSYPEESEGS
GEDELILGSGSGGGADVAGSGLGGSGDGGSGDGDFDEDDIPELVHVDEDFFYMEHVLRIA
ALLHSLVSLAMLIAYYHLKVPLAIFKREKEIARRLEFDGLFIAEQPEDDDFKSHWDKLVI
SAKSFPVNYWDKFVKKKVRQKYSETYDFDSISNLLGMEKSAFTAQESEETGILRYIMNID
WRYQVWKAGVTFTDNAFLYSLWYFSFSVMGNFNNFFFAAHLLDVAVGFKTLRTILQSVTH
NGKQLVLTVMLLTIIVYIYTVIAFNFFRKFYIQEEDEEVDKKCHDMLTCFVFHLYKGVRA
GGGIGDEIGDPDGDDYEVYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQLESVKDN
MESNCFICGMGKDFFDIVPHGFDTHVQKEHNLANYMFFLMHLINKPDTEYTGQETYVWNM
YQQRSWDFFPVGDCFRKQYEDELSGGGGGGG
Download sequence
Identical sequences B4LN92
XP_002048903.1.90633 7244.FBpp0235714 FBpp0235714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]