SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4LR79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4LR79
Domain Number 1 Region: 223-343
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-24
Family SH2 domain 0.00073
Further Details:      
 
Domain Number 2 Region: 636-806
Classification Level Classification E-value
Superfamily Ras GEF 1.29e-22
Family Ras GEF 0.02
Further Details:      
 
Domain Number 3 Region: 45-102
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000157
Family SAM (sterile alpha motif) domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4LR79
Sequence length 952
Comment (tr|B4LR79|B4LR79_DROVI) Uncharacterized protein, isoform A {ECO:0000313|EMBL:EDW63543.1} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=Dvir_GJ12514 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MGNVQTRQLESRNATNRRSSILWNFRYPQAARRRDDVAMIIHNSRLSIGEWLNLLELQQY
EGNLKMYATVDDVGDITDRDLKRLGIRSMSHRQKMLNSLLGVRAKRRQSMNLEALRSAPC
AVPRRKSSCPMVYLDADNMAGSNDSGGAAVITTKSGKVLKQLTFDETTTIYEELRPRSKC
NSPHWDNNANDMESGNNSNVSTPIAASPNPNEQQEAIALKKALEWELSLDARELRSHAWY
HGALPRQRAEEIVQREGDFLVRDCASQPDNYVLTCRSKSAVLHFVLNKLVLQPETVYERV
QYQFEEDAFDTVPDLITFYVGSGKPISAASGALIQYPCNRTYPLSFYGHKIVGNQLHTQM
LAGLRGLSPLNSPMGNSSAGGSAIFRFGQLAGDVPAQQQATVPAATPASPHCSPPRVRRE
VPPPRLPCKKQQRSQSLTPAQAMVVCNINKQQEQQQQQQQQQQQLAAADATNGHGLARFQ
TIARCNPTIDMQLQSQQLEHKFSTQSLPRPSTSAAQALRQQAAARICNLARNFSLDTPDR
APSPPPKPRKEPMAAVLAYQASGSDSGNGSGDSAPGDVSELSIQRGGVIIKNPRYMSSSA
SNGTLKSFTEFDALAAEEQLFTLPIEEFKLSSKFDFENFSTLLLPSVENKPLDGDALNTF
KMMLLETGPKLLAEHITRIDIGLFLDEPANETDCYLSCSGLELLTLPHGKVFREDLIERT
QCIKLMVAVTILTCQTDLDRAELLSKWIQIAVETKTALGNLFGFCAIMLGLCMQQIQKLD
QAWHILRQKYTDSAFTFEAKLRPTLSSMNEASNPQAPNTTVPHVLLYALLIDRPVLDIIN
HGNVDERPALYNTCIAPWETKADDFGMSINFQHLDASRGFLKNLDLYRKNAKIIMEEAST
RLDELLADAFRTEFHVKFLWGSSGATAKPEDRHGKLEKVLTLMADKFCSVSA
Download sequence
Identical sequences B4LR79
XP_002051388.1.90633 7244.FBpp0226931 FBpp0226931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]