SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4LYE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B4LYE0
Domain Number - Region: 34-60
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000141
Family Tachycitin 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4LYE0
Sequence length 61
Comment (tr|B4LYE0|B4LYE0_DROVI) Uncharacterized protein {ECO:0000313|EMBL:EDW66936.1} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=Dvir_GJ23348 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MNCSCAWLVMLLLALLGTAWGSSCPTGFSSETNLCVKERPVHGTCPPGSTYQLNINKCVH
A
Download sequence
Identical sequences B4LYE0
FBpp0237765 XP_002053416.1.90633 7244.FBpp0237765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]