SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4LYU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4LYU9
Domain Number 1 Region: 346-630
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.14e-40
Family Eukaryotic proteases 0.001
Further Details:      
 
Domain Number 2 Region: 163-205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 26-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 247-290
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000834
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 70-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000982
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 6 Region: 124-155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000641
Family LDL receptor-like module 0.0016
Further Details:      
 
Weak hits

Sequence:  B4LYU9
Domain Number - Region: 312-364
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0114
Family Complement control module/SCR domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4LYU9
Sequence length 637
Comment (tr|B4LYU9|B4LYU9_DROVI) Uncharacterized protein {ECO:0000313|EMBL:EDW67026.1} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=Dvir_GJ23926 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MVLKYFKLLLLSICVISLGFGARAVYGACGPTKFECDNGSCISKFDACDGVKNCPDGSDE
TGQTCVSHRKHCSKPYFQCSYGACVIGTAPCNGKNECADGSDETVLRCGTDDDILEFDKL
QQGNCQSNEFKCPSGICIDKSKYLCDGQDDCGDGSGYDEAVKFCGHIECPGYAFKCASGG
CISNQLTCNGKNDCFDGSDEAPLLCNTTGKPSEQPLVKPTNQMGCPLPVGDEQPILKDHR
GTYLTPPIVRATVYFSCNPGYVLEGAESSHCANGKWSLPIVPRCVKYCDSMRDSSGHSKN
LFNGYSTRATCIYNGQQVNCGQRYHPPGTEVKFVCATGFQTLRTTLPDIKCLPSGHWSRE
RERCDQECGEIATPIKQFSAFGYSVNNTVVPWHVGLYVLHNERDYNFVCGGTLLTPDLVI
TAAHCVFSQVSEQTYSLATFRVVAAKLYRGYNDVTSEDRKRDVKSIKVAPRYKGREDNFL
NDLALIVLEEPYQLSNVIRPVCVHFFDYALKESVNNEVRGQFAGWNFKDKRELQFVPAES
KINAVCGTSLRDIGADKFCMYTQGKSLACHGDSGGGFTAQRETQSFSRVTNRHYLYGVIS
SAPNAGQCAQSLTLLTNIQYFEDMINDAIRESIEFGS
Download sequence
Identical sequences B4LYU9
7244.FBpp0238343 XP_002053506.1.90633 FBpp0238343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]