SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4M221 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4M221
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.72e-26
Family Cold shock DNA-binding domain-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4M221
Sequence length 65
Comment (tr|B4M221|B4M221_DROVI) Uncharacterized protein {ECO:0000313|EMBL:EDW65725.1} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=Dvir_GJ19416 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGDILTLLESERE
ARRLR
Download sequence
Identical sequences A0A1W4VUF4 B3NT64 B4IDH1 B4JIP9 B4L8F0 B4M221 B4NDZ8 B4PWX1 B4R757 Q29ID4 Q9W334 X2JEM4
NP_001285059.1.81976 NP_572568.1.81976 XP_001355660.1.19638 XP_001977317.1.56816 XP_001991871.1.65300 XP_002011804.1.58863 XP_002041781.1.34323 XP_002055524.1.90633 XP_002070981.1.14588 XP_002101747.1.41174 XP_016038685.1.80810 XP_016936726.1.48971 XP_016948861.1.21709 XP_017012995.1.47939 XP_017038020.1.37106 XP_017055801.1.74164 XP_017064058.1.81094 XP_017094812.1.53830 XP_017114451.1.32376 XP_017114452.1.32376 XP_017148024.1.22881 XP_017852995.1.30616 XP_017869262.1.65068 XP_017962789.1.46654 XP_020808532.1.32911 FBpp0163595 FBpp0071295 FBpp0071295 FBpp0136862 FBpp0272676 FBpp0262808 FBpp0192852 7222.FBpp0146807 7227.FBpp0071295 7237.FBpp0272676 7244.FBpp0233833 7245.FBpp0262808 7260.FBpp0254523 DS10_00004931 FBpp0071295 FBpp0146807 FBpp0254523 FBpp0233833 FBpp0214454 4v6w_Ac

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]