SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4M9Y4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4M9Y4
Domain Number 1 Region: 22-82
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000418
Family Tachycitin 0.021
Further Details:      
 
Domain Number 2 Region: 86-149
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000706
Family Tachycitin 0.0059
Further Details:      
 
Domain Number 3 Region: 179-228
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000497
Family Tachycitin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4M9Y4
Sequence length 237
Comment (tr|B4M9Y4|B4M9Y4_DROVI) Uncharacterized protein, isoform A {ECO:0000313|EMBL:EDW66043.1} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=Dvir_GJ15813 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MKLFLCAIAVTLCVAATTGAAEFECPKPNGQFADEVQCDKYYVCDEGVPKAKLCPDGLVF
DPLNRKINKCDQPFNVDCEDRTELQEPKSTKYCPRKNGFFAHPEASVCNIFYNCIEGDAL
EMKCTVGLHFDEYSGTCVWPDTAKREGCGDPEKKSESGFACPKDQPKTDARGQVVTHPKY
PHPTDCQKFYVCLNGEDPRDLGCQLGEVYNDLTEMCDAPENVPGCEDWYKDTDDKKD
Download sequence
Identical sequences B4M9Y4
XP_002057935.1.90633 7244.FBpp0230230 FBpp0230230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]