SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4MAN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4MAN2
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000523
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 2 Region: 46-71
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000889
Family Somatomedin B domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4MAN2
Sequence length 403
Comment (tr|B4MAN2|B4MAN2_DROVI) Uncharacterized protein {ECO:0000313|EMBL:EDW66291.2} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=Dvir_GJ15945 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
LWLGVGQQLPLAAGGSCREAQLCCNGRDSSCVVQKAPVNAIIEDLSDKPCYCDHACLKLG
DCCDDFKDHCGVLDCQVGDWGAWSECDKSCGAGMMTRTRQILQAVQNGGKHCPSLLQKRA
CQGYRCHGHRDKKILREMALLLPAALSRSHHANNSSDLHHNLRTRYRDSYKHNRDHEYCV
EFEVIKASKACHKLPPYNLMLEGDRITVRCDLEALVQDAATATAGGKQGSRGAAATTTTT
TRKTPMAQPYSMDDGDDADRLDSSSSSSSSNNEDDNEDDEEETSEEDDAQNMLEPEAEPE
PEPETEVGSNESHEYKHQRQLHRARSATSKRSAAPILPPALQQKQREEEEQQQLLLSYHC
RGEGLSGRTTRWSALPAPSCRGKWLRLTIGPPKKCNHAQFIFV
Download sequence
Identical sequences B4MAN2
XP_002058183.2.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]