SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4MBM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4MBM4
Domain Number 1 Region: 28-274,351-398
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.93e-91
Family Type II chitinase 0.00000424
Further Details:      
 
Domain Number 2 Region: 274-350
Classification Level Classification E-value
Superfamily Chitinase insertion domain 2.9e-19
Family Chitinase insertion domain 0.00038
Further Details:      
 
Domain Number 3 Region: 513-570
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000146
Family Tachycitin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4MBM4
Sequence length 584
Comment (tr|B4MBM4|B4MBM4_DROVI) Uncharacterized protein {ECO:0000313|EMBL:EDW58495.1} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=Dvir_GJ14479 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MAYHHPMLLLLLLLGVPSLILGKDQPARIVCYFSNWAVYRPGIGRYGLEDVPGDLCTHLV
YSFIGVDEKSWDVLVIDPELDVDQEGFRKFTQLRQTHPKLKLQIAVGGWAEGGAKYSKMS
AVREHRQSFIRSVVQFMREYDFDGFDLDWEYPGATDRGGSFGDKDKFLYFVQELRRAFDR
EGRGWEITMAVPVAKFRLQEGYHVPELCELLDAIHAMTYDLRGNWAGFADVHSPLYKRKH
DQYAYERLNVHDGLALWEEMGCPANKLVVGIPFYGRTFTLSNSNKNYNMGTYINKEAGGG
APGPYTNASGFLAYYEICTEVMDKSKGWTVEWDEAGMVPYTYKDTQWVGYENEASVQIKM
DFIRAKGYAGAMTWAIDMDDFHGLCGPKNALMQILYNNMRDYRVPEPTRETTPRPEWAKP
PSTSPNPDEAVSNVRPTTTTRKPKPKPTSTAVRPTSAPAPAVPSTTEKPTTKKPKKPKTT
TTTTTTTTEAPELTEEPEPIVDPEENATTGVEFDPSEIDCTNRDFVPHPNCRKYFRCVHG
KPVEFECKEGTAFHTVLNVCDWIENSDRYYCTRMKNKDNGNETR
Download sequence
Identical sequences B4MBM4
XP_002058527.1.90633 FBpp0228896 7244.FBpp0228896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]