SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4MEY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4MEY9
Domain Number 1 Region: 94-543
Classification Level Classification E-value
Superfamily Sema domain 5.76e-132
Family Sema domain 0.000056
Further Details:      
 
Domain Number 2 Region: 1413-1542,1751-1912
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.12e-43
Family p120GAP domain-like 0.047
Further Details:      
 
Domain Number 3 Region: 905-1001
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000118
Family Other IPT/TIG domains 0.0093
Further Details:      
 
Domain Number 4 Region: 998-1086
Classification Level Classification E-value
Superfamily E set domains 0.00000000000255
Family Other IPT/TIG domains 0.081
Further Details:      
 
Domain Number 5 Region: 546-597
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000628
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 1105-1187
Classification Level Classification E-value
Superfamily E set domains 0.000000042
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.064
Further Details:      
 
Weak hits

Sequence:  B4MEY9
Domain Number - Region: 1216-1262
Classification Level Classification E-value
Superfamily E set domains 0.000252
Family Other IPT/TIG domains 0.074
Further Details:      
 
Domain Number - Region: 859-893
Classification Level Classification E-value
Superfamily Plexin repeat 0.000785
Family Plexin repeat 0.0046
Further Details:      
 
Domain Number - Region: 693-729
Classification Level Classification E-value
Superfamily Plexin repeat 0.00916
Family Plexin repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4MEY9
Sequence length 1969
Comment (tr|B4MEY9|B4MEY9_DROVI) Uncharacterized protein, isoform D {ECO:0000313|EMBL:KRF85333.1} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=DVIR88_6g0071 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MNMLCILCLLSITILGNLPSRSAHGQILHLYKKSNEQLNSGFTYAQPSVLDVRADRIGRS
AEALRVNITETDPNVLTRNAGNFSTNIITNVAKFDTRLNHLLVDTVTGRVFVGGVNRLYQ
LSPDLELHETVKTGPQNDSVECTILDCPLNAVRKPTDNYNKVLLIDRATSRLIACGSLFQ
GTCTVRNLQNVSIVEHEVPDAVVANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPY
RSEIPAVASRSLEKTKMFQIASSAVTTGTRTFINSYARETYLVNYVYGFSSERFSYFLTT
QLKHSHHSSPKEYITKLVRICQEDSNYYSYTEIPVECISEAQGGTKFNLVQAGFLGKPSS
DLAQSLGISIQDDVLFAVFSKGESNTPTNNSALCIYSLKSIRRKFMQNIKFCFNGNGMRG
LDFISPSMPCVLTKLQTIGEDFCGLDVNSPLGGEQPITAVPVAMFNTRVTSVAATSTSGY
TVVFIGTVDGYIKKVVVESATVANEYASLAVDLGSAINQDMQFDNQNLYVYAMSERKVSK
VKVYDCADFRTCGECLGAKDPYCGWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTIT
SVVPHQLQRTTARTLELIIDHLPQLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDM
LPQIEQGKHHFTAKLSVRTRNGPDLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRC
THDTAENCRNDILVTGVSRIGPSYRSGPGFCPTINATGDGSEVLVAAGTSKSIKVKVHII
GQFIVQTRFVCQFNIEGRVTSLNAQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKP
LDNPHNIHVVIYRCRVMADSCGICLALAEKYNCGWCSSTNTCEVVEQCNKNNEGKTDWLN
RSEICPNPEIHSFGPKTGPWEGGTNITIKGINLGKNYNDIYSGVRIAGINCMPFQQFYID
TKQIVCTVDSPGEQMYRNGRIVVQIGDYRGESKEDYEFVDPKISNFYPRFGPSSGGTQIR
IIGKHLNAGSRIQAFINDHLPCKIISTDSSQAICQTSPSPGIIEGRLKMSFDNGPREFND
YNFKYVLDPTVEQVSSGPSGQIKVPKGIPAGGIRIIVTGTQFTSIQAPSIYVFYKGQMYA
SQCRVQSDNEMECPSPTIEADSQILDPENPTLLEYGFLMDNVLKVQNLSKKHNNHFELYP
NPEYFTFEERVKYFKSEYLTINGRNLDRACKETDVEVKIGNGYCNITSLSRQQLTCRPPT
EAVAASNSPNGPEVIVRIGSSLEYRIGILSYESSNLIMDWGDNVVFVVIAGCVIFFLIFC
ALLVAYRKKTAESHRELRNMQEQMDILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPF
LDYRSYAMKILFPNHEDHVVLQWERPELLRKEKGLRLFAQLIMNKTFLLLFIRTLESNRY
FSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKM
LSAWFTFLLYKFLKECAGEPLYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDF
RPMTVNASIIQQPIFCNNLDMLPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRP
RKDDLDLEWRTGATGRVILYDEDATSKTENDWKKLNTLQHYNVPDGAGLSLVPKQSSIYN
FSILSDKNEKSHKYETLNISKYTSSSPTFSRAGSPLNNDMHENGMKYWHLVKHHDSDIQK
EGERVNKLVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQA
LLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCST
SDHRLGKDSPSSKLLYAKDIPEYRKWVDRYYRDIRDMSSISDQDMNAMLAEESRLHTTEF
NTNCALHELYTYAVKYNEQLTVTLEEDEFSQKQRLAFKLEQVHNIMSAE
Download sequence
Identical sequences B4MEY9
XP_002059692.2.90633 XP_015024131.1.90633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]