SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4MF19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4MF19
Domain Number 1 Region: 107-560
Classification Level Classification E-value
Superfamily Sema domain 2.75e-118
Family Sema domain 0.0000362
Further Details:      
 
Domain Number 2 Region: 1514-1639,1849-2033
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-42
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 916-1006
Classification Level Classification E-value
Superfamily E set domains 0.00000000000056
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 4 Region: 562-613
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000706
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 1123-1193
Classification Level Classification E-value
Superfamily E set domains 0.0000000000168
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.06
Further Details:      
 
Domain Number 6 Region: 1007-1083
Classification Level Classification E-value
Superfamily E set domains 0.000000021
Family Other IPT/TIG domains 0.024
Further Details:      
 
Weak hits

Sequence:  B4MF19
Domain Number - Region: 864-897
Classification Level Classification E-value
Superfamily Plexin repeat 0.000112
Family Plexin repeat 0.0029
Further Details:      
 
Domain Number - Region: 1295-1357
Classification Level Classification E-value
Superfamily E set domains 0.00735
Family Other IPT/TIG domains 0.057
Further Details:      
 
Domain Number - Region: 709-745
Classification Level Classification E-value
Superfamily Plexin repeat 0.0144
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4MF19
Sequence length 2069
Comment (tr|B4MF19|B4MF19_DROVI) Uncharacterized protein {ECO:0000313|EMBL:EDW71120.1} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=DVIR88_6g0024 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MLQQIFCQHGAVYILDAFFLLLQLHSAVDCIKVEHANTHPHSHLEVYNKQFPSSDIVAQF
ALPPIAGGVAGGIFDTGGGGSSTSTSTEANFGNRTNSANRLGIGANSQSKNYFTHLTFDY
THNVLYAGATNKILKLNENLRVLSEAVTGPKHDAPQCHAGGCPEDVETVLVNNFNKILVV
SYAHNDGILISCGSIRQGACEIYNLLRFPAAPQFVAVPLAANDEYASTYAFVGPARYSWK
EEDILYVGTTFTNVGDYRHDVPAISSRRLDDLNYAEFSIQQSIINIDVKYRDHFLVDYVY
GFNSSEYAYFVLVQKKSHLAEEAGYVTRLARICITDPNYDSYTEITIQCTATDDHTDYNI
LRDAKITHASQKLAYQMGIKRDDHVLVTVFSPSKDISDQPENKSAMCIYSLKDIEDVFIE
NIHMCFNGTIKDRNLGYISGTINDGRCPIVGSLGNIYNFCNVGLKISGVAPISAHALFHF
DNVSVTSVTATTTTDQQHSLAFLGTEAGTVKKVLLSGQNPGEYEEIVVDAGSRILPNTMM
SPKKDFLYVLSTRKITKLRIEHCSVYSNCSACLESRDPFCGWCSLEKRCTVRSTCQRDTS
ASRWLSLGSGQQCIDFESIVPDKIPITELTQVQLVIRTLPEPFNAKYRCVFGNSTPIDAE
ILEHGLACATPPIDQRPSIAANMDHILVPLSVRSSETNKDFVSRSFAFFDCSHHANCQSC
VRSSWGCNWCIFDNKCVHKLEQCRNMENAISAEGQCPHLKRNRQPILLPVRVPKEIRLEI
ENLPKPKSAHAGYLCTIQIEAAQMLLPAHIESNKIVVCEKTPYFYETNTHEYEAKVEITW
NRQHYVDTATVILYKCDVLGSHREHADCSLCVTRDPKYQCAWCGSSCVYNETCAGSVGHG
YDTATLGSALPLQNECPRPRIDIIKPLSGPIEGGTLVTIEGSNLGIREEDVRGKISIGTV
PCDLVNYQISVKIECRTGAALHEMSAPIKVANDAGYTESSVQFHFKDVQLTGLYPTVGPK
SGGTQLSLLGKYLNIGSSIRAFLDEYECHINVTQASSSRLSCITSEATQPEPIRSLRLVV
DGANRTFTCKSPDFGQQQLISTSRSYYGAYYNMPPPPCSIFNYTQDPRIMQIKPLRSFVS
GGRILTVHGMYLDSIQNPELEVFFDNERVNKTSCTVINSSQMECPSPPVNLKFELLKSAI
ETSSKSEQGKDKSKRKRNALFNDSFNIYATGSTASSYFASNSMDVAAFVKVHETQLNLQL
SFVMDNVQLVRDLNKYFHDIRSTIVYLTDPKYLPFPNNGIKLYKGDTLVIEGELLNLAAD
EYDVNVTIGTAQCNITSLALTQLLCIPPEQQPSATDENGVDQSTDLPLVVVKVGRNLRFV
IGYLKYDLNKPYALSHAMLGIILTVVSLIIVLIVVLIMFRRKSTQAEREYKRIQIQMITL
ESNVRSECKQAFAELQTDMTDLTADLESSGIPTLDHVNYIMKVFFPGVSDHPILNSPKMR
GNSQHTNYDTAMMQFEQLVSNKYFLLTFIETLEAQRSSFSIRDRVNVASLLMIVLMNKME
YATEILKCLLLRLIEKSLASKHPQLMLRRTESVVEKMLTNYLAICMYDYLKEYAGSSLFL
LFKAIKHQVEKGLVDAITHDARYSLSEERLLHEQVTHSVVILHILQDDLDEKVQCRVNDW
DTISQVKLKILDAIFKNTPFSMRPSVHEVDLEWRHGRGGHLTLQDEDLTTKTINGWKRLN
TLSHYGVKESAVMSLIARQNDSYNMPYSKQQAPYHNFYYINNSQSHIIINNDIESGLQQP
RLYHLVKPIIPDHYMNIKNSAMSGVLAPAQGGTHCIVNGSERVNKTIPEVYLTRLLATKG
TIQKFVDDFFSIILTVNEELPPAVKWLFDLLDEAARRHNIAETDILHAWKSNSLPLRFWV
NFIKNPDFIFDVNKTYSVDSCLSVIAQTFMDACSTAEHRLGKDSPSNKLLFAKDIPNYRT
MVKEFYRDVARLPQISDQEMSTAMQQLSVQQNEEFDTISALKELYIYITKYREQIMDALD
SDPNCKKMHLSSKLESVACTLDGEDTSNC
Download sequence
Identical sequences B4MF19
XP_002059722.1.90633 7244.FBpp0229105 FBpp0229105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]