SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4MFY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4MFY6
Domain Number 1 Region: 277-543
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-80
Family Protein kinases, catalytic subunit 0.0000000533
Further Details:      
 
Domain Number 2 Region: 160-306
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-34
Family SH2 domain 0.0000397
Further Details:      
 
Domain Number 3 Region: 97-209
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-22
Family SH3-domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4MFY6
Sequence length 554
Comment (tr|B4MFY6|B4MFY6_DROVI) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=7244 OS=Drosophila virilis (Fruit fly). GN=Dvir_GJ15487 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MGNKCCSKRQDQELALAYPTGGYKKSDYTFGQTHINSNSSVGAGVVAALGQKHNNGGSLD
SRYTPDPNRGPLKIGAKGGVDIIRTRTTPTGVPGGLPKRRVVVALYDYKSRDESDLSFTK
GDRMEVVDDTESDWWRVVNLTTRQQGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLA
EENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGFYIATNQTFASLQ
ALVMAYSKNALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEV
FYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQEEPIYIVQEY
MSNGSLLDFLREGEGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVA
KICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQ
VPYPGMHSREVIENIERGFRMPKPTIHYFPDNIYHLLLQCWDAVPEKRPTFEFLNHYFES
FSVTSEVPYREVQD
Download sequence
Identical sequences B4MFY6
XP_002060036.1.90633 7244.FBpp0229904 FBpp0229904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]