SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4PKB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4PKB9
Domain Number 1 Region: 9-337
Classification Level Classification E-value
Superfamily ARM repeat 5.12e-126
Family Mo25 protein 0.000000000868
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4PKB9
Sequence length 339
Comment (tr|B4PKB9|B4PKB9_DROYA) Uncharacterized protein {ECO:0000313|EMBL:EDW94817.1} KW=Complete proteome OX=7245 OS=Drosophila yakuba (Fruit fly). GN=Dyak_GE22202 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPLFGKSQKSPVELVKSLKEAINALEAGDRKVEKAQEDVSKNLVSIKNMLYGSSDAEPPA
DYVVAQLSQELYNSNLLLLLIQNLHRIDFEGKKHVALIFNNVLRRQIGTRSPTVEYICTK
PEILFTLMAGYEDAHPEIALNSGTMLRECARYEALAKIMLHSDEFFKFFRYVEVSTFDIA
SDAFSTFKELLTRHKLLCAEFLDANYDKFFSQHYQRLLNSENYVTRRQSLKLLGELLLDR
HNFTVMTRYISEPENLKLMMNMLKEKSRNIQFEAFHVFKVFVANPNKPKPILDILLRNQT
KLVDFLTNFHTDRSEDEQFNDEKAYLIKQIKELKPLPEA
Download sequence
Identical sequences A0A1W4UVA2 B4PKB9 B4QMW4 M9PI82 P91891
FBpp0075117 7227.FBpp0075117 7245.FBpp0267212 FBpp0075117 FBpp0303950 FBpp0267212 FBpp0210855 7294077___KOG1566 DS10_00010080 NP_001261958.1.81976 NP_524117.1.81976 XP_002085171.1.80810 XP_002095105.1.41174 XP_016924423.1.48971 XP_016966691.1.21709 XP_016980742.1.97277 XP_017043124.1.74164 FBpp0075117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]