SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4PMX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4PMX1
Domain Number 1 Region: 336-621
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.26e-42
Family Eukaryotic proteases 0.001
Further Details:      
 
Domain Number 2 Region: 161-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000126
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 68-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000903
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 5 Region: 243-287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000264
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 6 Region: 122-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000131
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4PMX1
Sequence length 628
Comment (tr|B4PMX1|B4PMX1_DROYA) Uncharacterized protein, isoform C {ECO:0000313|EMBL:EDW96983.2} KW=Complete proteome OX=7245 OS=Drosophila yakuba (Fruit fly). GN=Dyak_GE26132 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MQLKSILSNPLFLCAVLLRCRTISAACESSQFECDNGSCISQYDVCNGERNCPDGSDETA
LTCVSQRQHCTKPYFQCTYGACVIGTAGCNGVSECADGSDETRLRCGNEDDIRQHDRRLQ
GNCQENEFKCPSGICLDKSNFLCDGKDDCADGTGFDESVELCGHMECPAYSFKCGTGGCI
SGSLSCNGENDCYDGSDEAPLLCNTTKKVTTPVVTETPLELLGCPLPVGDERPILTGDGN
RVLTGPITRGTVRFSCKQGHVLEGEESSYCAKKKWSTSTIPKCVKYCSTAGEFDGYSTKA
LCTHNGQQVDCRKPFHPPGTEVKFVCSTGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCGQ
IATPITTFSSGGYTINNRVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEG
TRLPYSYDTFRVIAAKFYRNYGETTPDDKRRDVRLIEIAPGYKGRTENYYQDLALMTLDE
PFELSNVIRPICVTFASFAEKESVTHEVQGKFAAWSIENKHELQFVPAVSKSNSECRKNL
RDIQADKFCIFTQGKSLACQGDSGGGFTSELQTNAFSAWKTARHFLFGVISNAPNADQCA
HSLTVMTNIQHFEDMILNAMNRSVETRS
Download sequence
Identical sequences B4PMX1
XP_002097271.2.41174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]