SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4PZL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4PZL3
Domain Number 1 Region: 98-397
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.53e-31
Family NodB-like polysaccharide deacetylase 0.012
Further Details:      
 
Domain Number 2 Region: 28-89
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 7.32e-16
Family Tachycitin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4PZL3
Sequence length 486
Comment (tr|B4PZL3|B4PZL3_DROYA) Uncharacterized protein {ECO:0000313|EMBL:EDX03141.1} KW=Complete proteome OX=7245 OS=Drosophila yakuba (Fruit fly). GN=Dyak_GE15265 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MLRQCLVAVLLVIAGANGQGKEKEEFQCPSHIANGNYADPATCRRFYQCVDGYPYLNRCP
SGLFFDDVQKFCTFKDEAKCGPLPTTPAPATEAPADTAQRCNTENCALPYCFCSKDGTQI
PGDLEPEKIPQIIMLTFDGAVNLNNYQHYLKIFDGKRKNPNGCLIRGTFFMSHEYSNYQQ
IQHLGYYGHEIGTESISQQQGLQDKGYEEWVGEMIGMREILRHFSNVSVNDVVGMRAPFL
KPGRNTQYKVLEDFGYIYDSSITVPPVPVPVWPYTLDYKISHECKSGTCPSRTFPGVWEV
PLNTHYVEGYEGGHCPYLDQCVLHNLDEEEVFQWLQEDFSRYYEQNKAPYMMPFHTNWFQ
TKPLENGLHKFLDWALDLPDVYILTVTQMLQYMTDPKELRDVSQIESWKCDKSVSVAPKP
CNIWQTCALPFKIPEQNLTDTRYMETCRECPNVYPWLGDAGGTGIAGRDNYIFAGGENPE
EEETAK
Download sequence
Identical sequences B4PZL3
XP_002102033.1.41174 FBpp0260275 7245.FBpp0260275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]