SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4Q0P3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4Q0P3
Domain Number 1 Region: 952-1119
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.19e-44
Family Lysophospholipase 0.08
Further Details:      
 
Domain Number 2 Region: 168-305
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-23
Family cAMP-binding domain 0.013
Further Details:      
 
Domain Number 3 Region: 627-737
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-21
Family cAMP-binding domain 0.01
Further Details:      
 
Domain Number 4 Region: 1122-1302
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 8.11e-21
Family Lysophospholipase 0.072
Further Details:      
 
Domain Number 5 Region: 490-621
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.76e-16
Family cAMP-binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4Q0P3
Sequence length 1467
Comment (sp|B4Q0P3|SWS_DROYA) Swiss cheese {ECO:0000250|UniProtKB:Q9U969} KW=Complete proteome OX=7245 OS=Drosophila yakuba (Fruit fly). GN=sws OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MDVLEMLRASASGSYNTIFSDAWCQYVSKQITATMYMYCAFGLMGVLFLAWFMYFKRLAR
LRLRDELARSISSVTNSYGDLRGLRFRKRDKMLFYGRRMLRKMKNVSGQMYSSGKGYKRR
AVMRFARRILQLRRDNMPLEMRTVEPPAEYLEETIEGSDRVPPDALYMLQSIRIFGHFEK
PIFLRLCKHTQLLELMAGDYLFKITDPDDSVYIVQSGMINVYISNADGSTLSLKTVRKGE
SVTSLLSFIDVLSGNPSYYKTVTAKAIEKSVVIRLPMQAFEEVFQDNPDVMIRVIQVIMI
RLQRVLFTALRNYLGLNAELVQNHMRYKSVSTMSGPINSQTSQSSRQATANGPPMVINQL
NLMQSAASGLGMGMGTGTGSGVSVTVTRPPPSPSRHSREEHTLSDPNPNPDGSVHGTSNL
FTEVHGDAPNADLFHQQQQSVGNLSTRRSSITQMTPDGSHTCPQAPGVTTSIDMRLVQSS
AVDSLRKELGLSEEDAHIIEPFVELRELEPNVTLITEGNADDVCVWFVMTGTLAVYQSNQ
DATRAKQDKNDMLIHFVHPGEIVGGLAMLTGEASAYTIRSRSNSRIAFIRRAAIYQIMRQ
RPRIVLDLGNGVVRRLSPLVRQCDYALDWIFLESGRAVYRQDESSDSTYIVLSGRMRSVI
THPGGKKEIVGEYGKGDLVGIVEMITETSRTTTVMAVRDSELAKLPEGLFNAIKLRYPIV
VTKLISFLSHRFLGSMQTRSGSGAPGAPVEANPVTHKYSTVALVPITDEVPLTPFTYELY
HSLCAIGPVLRLTSDVVRKQLGPNIFEAANEYRLTSWLAQQEDRNIITLYQCDSSLSAWT
QRCMRQADVILIVGLGDRSHLVGKFEREIDRLAMRTQKELVLLYPEATNAKPANTLSWLN
ARPWVTKHHHVLCVKRIFTRKSQYRINDLYSRVLLSEPNMHSDFSRLARWLTGNSIGLVL
GGGGARGAAHIGMLKAIQEAGIPVDMVGGVSIGALMGALWCSERNITTVTQKAREWSKKM
TKWFLQLLDLTYPITSMFSGREFNKTIHDTFGDVSIEDLWIPYFTLTTDITASCHRIHTN
GSLWRYVRSSMSLSGYMPPLCDPKDGHLLLDGGYVNNLPGHLWRYCRASMSIAGVFPPFC
DYRDGHLLLDGCYTNNVPADVMHNLGAAHIIAIDVGSQDDTDLTNYGDDLSGWWLLYKKW
NPFTSPVKVPDLPDIQSRLAYVSCVRQLEEVKNSDYCEYIRPPIDKYKTLAFGSFDEIRD
VGYVFGKNYFENMAKAGRLGRFNQWFNKEPPKRVNHASLNEYTFIDLAQIVCRLPETYAV
NTAELFSEDEDCDGYISEPTTLNTDRRRIQVPRAGNSLSFSETEMDSDVELDLKLERKMD
KSTQSTPPTSSRASVRGKEEARHMDNWHWSVKHKVETASGATEATNAMIDQEQQHQQQAD
QGVGAEQLADKDEDKENRSSTYNETKN
Download sequence
Identical sequences B4Q0P3
7245.FBpp0262502 FBpp0262502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]