SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4QAV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4QAV7
Domain Number 1 Region: 20-169
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-49
Family APC10-like 0.00000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B4QAV7
Sequence length 195
Comment (tr|B4QAV7|B4QAV7_DROSI) Anaphase-promoting complex subunit 10 {ECO:0000256|PIRNR:PIRNR028841} KW=Complete proteome; Reference proteome OX=7240 OS=Drosophila simulans (Fruit fly). GN=Dsim_GD25470 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAASMDEDITANPPPSSEEDPLAEERLGFVREVGAQAVWSLSSCKPGFGVERLRDNIMDT
YWQSDGQLPHLVNIQFHKRTNISQIYIYTDYKLDESYTPSRISIRSGTNFNDLQELQVMD
LTEPTGWVQIPIKDGNVKSIRTFMLQIAVISNHQNGRDTHMRQIRIHAPVEGKHYPLELF
GKFGTVDFQKFATIR
Download sequence
Identical sequences B4HMV6 B4QAV7 Q9V831
FBpp0086107 7227.FBpp0086107 FBpp0086107 FBpp0086107 FBpp0201451 FBpp0223872 NP_611223.4.81976 XP_002034293.1.34323 XP_002081923.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]