SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4ST20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4ST20
Domain Number 1 Region: 28-272
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.05e-47
Family IroE-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4ST20
Sequence length 280
Comment (tr|B4ST20|B4ST20_STRM5) Putative esterase {ECO:0000313|EMBL:ACF52811.1} KW=Complete proteome OX=391008 OS=Stenotrophomonas maltophilia (strain R551-3). GN=Smal_3112 OC=Stenotrophomonas maltophilia group.
Sequence
MRLIALSLLLSVVSAAPLMAAESASPAAASPLVIGETFTIESKALGETRRINVYRPQPWG
LDPKAPLPVLYMADGGIAEDFLHVAGLVQVLSGNGSMRPFLLVGIENTERRRDMTGPSND
PQDQKIAPRIGGSAAYRRFLRDELMPQVRQRYPTTDERALIGESLAGLFVVETLLQEPTL
FNSYIALDPSLWWNHGAMLAGAAKQLPAVTRAQPQVFLASSGQPELAASTARLAALLQQA
SPSPLVKYLPLPEETHATIYHPAALQALRTLFPAPPPASP
Download sequence
Identical sequences B4ST20
391008.Smal_3112 gi|194366884|ref|YP_002029494.1| WP_012511891.1.100705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]