SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4U7B9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4U7B9
Domain Number 1 Region: 104-462
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 7.59e-52
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0008
Further Details:      
 
Domain Number 2 Region: 7-97
Classification Level Classification E-value
Superfamily Cytochrome c 4.73e-18
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.023
Further Details:      
 
Domain Number 3 Region: 464-550
Classification Level Classification E-value
Superfamily Cytochrome c 0.00000000458
Family monodomain cytochrome c 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4U7B9
Sequence length 557
Comment (tr|B4U7B9|B4U7B9_HYDS0) Cytochrome d1 heme region {ECO:0000313|EMBL:ACG57030.1} KW=Complete proteome; Reference proteome OX=380749 OS=Hydrogenobaculum sp. (strain Y04AAS1). GN=HY04AAS1_0340 OC=Bacteria; Aquificae; Aquificales; Aquificaceae; Hydrogenobaculum.
Sequence
MRIRLIFLSLLLCCPLLSSFSSPASLGGDLYKDKCAKCHGINRMGLSGPPLIPEFLKSKS
DNTLFKIIKNGIPPTLMPSFKDLTDKQIESLIAFVKTPVTVNTWSLSDIRKTWYKLSAQN
PKPWHRTIVNFMALVEAGKNRVWFLNKAHVINKINFGDIHGGLKFSNDGKFIYIPSRTGY
IGRYNIRKGYLDYKVRACLYQRNVSLFSNGVISACWLPSQIVILNKKLEPKAVIPIDGKI
SAIYGLYNSPYAVFGLMHKSVLGFLNTSSLNLKYYDVPTAFEDFFIDPLEHFVVGTSFNH
NVLSVFDIKSKKIVYQTSFGGMPHLASAAFWYKDKNFYFATPDLKKPVITIWRAYKWKKI
KEIPSKGVGFFVKTNPNTPYLWADEHANTLLLIKKTDFKPIHVKLVKKGWIIHTQFSGDG
KYAYVSDYAKNGNVFILDSTTLKLIKSFPASYPIGKYNYVTYSNRREAALLGEEVYLQYC
WGCHHPTRTAFAPSFKYIAKHIPISLIKAQILSPDQTYKLLGFKQNVMPKFHLSKYEIDA
LLMFIEYSKNRNFWDSH
Download sequence
Identical sequences B4U7B9
gi|195952718|ref|YP_002121008.1| 380749.HY04AAS1_0340 WP_012513386.1.45798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]