SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4VRJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4VRJ7
Domain Number 1 Region: 8-213
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.75e-24
Family Haloperoxidase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B4VRJ7
Sequence length 214
Comment (tr|B4VRJ7|B4VRJ7_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:EDX75433.1} KW=Complete proteome; Reference proteome OX=118168 OS=Coleofasciculus chthonoplastes PCC 7420. GN=MC7420_1351 OC=Coleofasciculaceae; Coleofasciculus.
Sequence
MKIVLRYIYLHGLASNPGSAKAVYLRDRFAELGVSLFVPDLNQGDFSHLTLTRQIQQIQA
ECLSTPTPITLIGSSLGGLTAAWLGEYHTFIQRLVLLAPAFGFLWSWLSTLGEEALHQWQ
VEGYRPIYHYGEQKELPLSYKFVEDIRQYEQTHRLKRPIPTLILHGQHDEVIPINESLIY
AKERSWVQLIPFNSDHSLSDVKAEIWQSILAFCQ
Download sequence
Identical sequences B4VRJ7
WP_006101143.1.59225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]