SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5DFL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5DFL4
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-33
Family Nuclear receptor ligand-binding domain 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B5DFL4
Sequence length 161
Comment (tr|B5DFL4|B5DFL4_RAT) Rorc protein {ECO:0000313|EMBL:AAI69105.1} OX=10116 OS=Rattus norvegicus (Rat). GN=Rorc OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MEVVLVRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEI
ALYTALVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCS
QHVEKLQDFQHLHPIVVQAAFPPLYKELFSTDIESSEGLSK
Download sequence
Identical sequences B5DFL4
ENSRNOP00000058884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]