SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5E010 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5E010
Domain Number 1 Region: 58-74,112-182
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000371
Family Insect pheromone/odorant-binding proteins 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B5E010
Sequence length 235
Comment (tr|B5E010|B5E010_DROPS) Odorant-binding protein 56c {ECO:0000313|EMBL:EDY69270.1} KW=Complete proteome; Reference proteome OX=46245 OS=Drosophila pseudoobscura pseudoobscura (Fruit fly). GN=Dpse_GA24250 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MFFRNQFLFLLCLGLSDLLPLAWSRSLTVTLNMSLTRSVEEDEKNPTKATLTEDMLQSCI
RRTEISMSQLKLFHMSLLNNDYNNENDVVPPIPLGENSLPDSEYGISSQMPYLDIKGNEP
LQCFVSCLYENIDVYRYNILLEHAFRQQVQTMLQKEKPAVKECSDLQGRTRCEAAYKLHL
CYNHLKTLEAEQRIRDIIERSEMGEGDLGLDGEKDPAGEVIDGIQHSNEAESKEE
Download sequence
Identical sequences B5E010
XP_002138712.1.19638 FBpp0276210 7237.FBpp0276210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]