SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5F700 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5F700
Domain Number 1 Region: 75-193
Classification Level Classification E-value
Superfamily PapD-like 4.97e-39
Family Pilus chaperone 0.0000288
Further Details:      
 
Domain Number 2 Region: 187-269
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 9.94e-17
Family Periplasmic chaperone C-domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B5F700
Sequence length 275
Comment (tr|B5F700|B5F700_SALA4) Chaperone protein FimC {ECO:0000313|EMBL:ACH50842.1} KW=Complete proteome OX=454166 OS=Salmonella agona (strain SL483). GN=SeAg_B0025 OC=Enterobacteriaceae; Salmonella.
Sequence
MLPRRRHLAWFIPDSLSGFFSRLLGGEKGALRASLRVTNRRHQDITQMKKNVPIFLRLLL
LLSAAGLSFAAQAGGIALGATRVIYPQGSKQTSLPIINSSASNVFLIQSWVANADGSRST
DFIITPPLFVIQPKKENILRIMYVGPSLPTDRESVFYLNSKAIPSVDKNKLTGNSLQIAT
QSVIKLFIRPKNLAEAPAHAPSTLRCRNERGQLTITNPSPYYVSMVELYSAGKKLPNTMV
PPKGAITLPATPGQVSLRTVNDFGATTPARVCPAS
Download sequence
Identical sequences A0A0F6AWE5 B5F700 Q57TN4
ABFH02000001|CDS_268360-267533 AE017220|CDS_24972-25799 CP001138|CDS_24973-25800 CP001363|CDS_24971-25798 gi|563651627|ref|YP_008859680.1| 321314.SC0021 454166.SeAg_B0025 gi|62178591|ref|YP_215008.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]