SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5FYW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5FYW2
Domain Number 1 Region: 81-212
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.56e-38
Family Glutathione S-transferase (GST), C-terminal domain 0.00000482
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.44e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B5FYW2
Sequence length 222
Comment (tr|B5FYW2|B5FYW2_TAEGU) Putative glutathione S-transferase class-alpha variant 2 {ECO:0000313|EMBL:ACH44223.1} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=LOC100190204 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MAGKPKLHYTKGRGKMESIRWLLAAAGVEFEEEFIETKEDLEKLRNDGVLLFQQVPMVEM
DGMKMVQTRAILSYIAAKYNLYGKDLKERAWIDMYVEGTTDLMGMIMYLPFQPADTKEKN
LALIIERATTRYFPVYEKALKDHGQDYLVGNKLSWADVHLLEAILMVEECKPDVLSAFPL
LQAFKGRISNIPTIKKFLQPGSQRKPPIDEKFVAVVRKIFNI
Download sequence
Identical sequences B5FYW2
NP_001232758.1.42559 ENSTGUP00000013268 59729.ENSTGUP00000013268 ENSTGUP00000013268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]