SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5U9X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5U9X6
Domain Number 1 Region: 11-301
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.29e-57
Family Duffy binding domain 0.00000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B5U9X6
Sequence length 669
Comment (tr|B5U9X6|B5U9X6_PLAYO) Erythrocyte-binding-like protein {ECO:0000313|EMBL:BAG71924.1} OX=73239 OS=Plasmodium yoelii yoelii. GN=pyebl OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
DYFDKYQVNECKEKNKNEIHAWICDNEKQNCIPSRRINLCTKRLEIIPDTIKIPDNKTKE
LLMDYFKQFIYKDAAREGELLLNKYDDKNNNEYCNDMINSFGDYKNIVEGTGLKNVANES
LLELKIQNIFGTDDNAKRNRKTWWKNHEHIVWKAMVLGKNFNETSNYKNVCTNYKLEDYH
SQIERWTREWIQEFSVQYFKEANKINNKCTKKSNISTESICINNECKNACNTYEAWISVN
KSKWDTLLQRFSQFNKSYFSEETCRDKAYNSLMIEFKEAYEANFENVINLDDDHYTGLCV
CSSVKPSNTPINNNLGYKQTLETQNPTDASQNTLFPPFSTGTETDLFKEDDDDNGGFDLL
SYNNADAQNLRNSTPTDQVGVNNEQNKLNQNAESNNKYELQIMGNHANSDNTYHNIIIPS
QENNIYTSTPESVTINPTSTSNTNENQTLTPNSTLTPTLTSNSNPTQIPTQPQPQFPIPP
QPQFPIPPETQFPIPPETQIPTPTLNPNATNKGVKEHHFNTNGIENGNTMKDQMNIPPIK
FNIDPKHDNTINGGFSRINNDNDSENANKLGIDEYEHRDIKKSRENIIMLANENVCNGNP
GLKYRESINNKYFHGTCSKSQTQNLCCSISNYCIKFFNINSKKYYDCMNEEFMAPDYNCF
QKESYSNQY
Download sequence
Identical sequences B5U9X6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]