SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5U9Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5U9Y0
Domain Number 1 Region: 5-295
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.67e-55
Family Duffy binding domain 0.000004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B5U9Y0
Sequence length 622
Comment (tr|B5U9Y0|B5U9Y0_PLABE) Erythrocyte-binding-like protein {ECO:0000313|EMBL:BAG71928.1} OX=5821 OS=Plasmodium berghei. GN=pbebl OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
PINECKEKDKNEIHAWICDDEKQNCVPSRRINLCTSRLEIIPDKIDIKDNEMKELLMDYF
KQFIYKDAAREGELLLNKYNEKNNNEYCNDMINSFGDYKNIVEGTGLNNVANSNLLELKI
QNIFGANDNGKRDRRNWWKRHEHIIWKAMVLGTNFNENSNYNNICINYKLEDYHSQIERW
TREWIQEFGVQYFKEAIKINNKCTKKSIISTESICINNACKDECNTYETWISVNKSKWDA
LLQRFSEFNKNYFSEETCRDKAYNSLMIEFKEAYEVNFENVINLDDDHYTELCVCSSARP
SNTAINKSLDHKQTLESQNPTDASQNNLLPPSNTNTNHDLFKEDDDDNNGFDLLSYSNTD
AQNSRNSTATEQVSVNDEKNKLNQNAESNNKYELQIMGNHSNSDNTYHNIIIPPQENHIQ
NIHTSIPQSVTSNPTLNTNTNGNINGNTDGDTNSTLTPNLDLNPTQTLNPNATNIEVKEH
HFSTNGTENKNTKKEQMSTSQIKYNKDPKHDNIISGDVSRSNNDINSENANKLEIYEYEN
RNVKKTRENIIMLANENVCNGNPGLKYCESINNKYFHGACPKSQTQNLCCSISNYCIKFF
NINSNNYYSCMNEEFMDPSYTC
Download sequence
Identical sequences B5U9Y0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]