SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5U9Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5U9Y2
Domain Number 1 Region: 10-300
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.89e-52
Family Duffy binding domain 0.00000719
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B5U9Y2
Sequence length 613
Comment (tr|B5U9Y2|B5U9Y2_PLAVN) Erythrocyte-binding-like protein {ECO:0000313|EMBL:BAG71930.1} OX=54757 OS=Plasmodium vinckei vinckei. GN=pviebl OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
YFDNHQINECKQKEKTEIHAWVCDEKKKNCVPSRRVNLCTNRLEIIPDKIEITDYEMKES
LMDYFKKFIYGDAASEGKLLLNKYDDKNNNEYCNDMVNSFGDYKNIVEGTGLTNVANANS
LELKIQNIFGTDDNAKRDRKIWWKNHENIIWKAMVLGKDFNEASNYENICTNYKIEDHHS
QIERWAREWIQEFSVQYFKEANKINNKCIKRSNIFTESICTDNDCKITCNAYETWINGNK
SKWNTLLQSFANFKNDYFNEETCKDKAYNSLMIEFKEAYEVNFENVINLDDDHYTGLCVC
SSTKANNTVIDNSLSSDHAIESQKPTDESHNNLLPPSNADTVPDLFKEDDDDSEELNLFS
YHNIDSQDSSNIIPTEQATVNKEQNKLNQTAESDTQYKLQIMDDHVNSDNTYHKIKIPPQ
ENNIQNIAPSIPEPVIVNPTPNSANKGVKEHEFNTNVLENRGTKDEGIKSFQIPSKNDPK
YDPKYDPKYNPKNDPKNNPKYDNILSGDIGISNNDINSENVKKLEIYEYEHRDIKKTRDS
IITLATANVCNDNPAFEYCKSINNKYSHGVCPKNKTQNLCCSISNYCIKFFNINSKKYYD
CMNKEFTDPSYEC
Download sequence
Identical sequences B5U9Y2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]