SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5VIZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5VIZ9
Domain Number 1 Region: 141-305,439-566
Classification Level Classification E-value
Superfamily TPR-like 1.2e-25
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number 2 Region: 871-910,959-1024
Classification Level Classification E-value
Superfamily TPR-like 0.0000461
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B5VIZ9
Sequence length 1025
Comment (tr|B5VIZ9|B5VIZ9_YEAS6) YGR047Cp-like protein {ECO:0000313|EMBL:EDZ72095.1} KW=Complete proteome OX=545124 OS=Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast). GN=AWRI1631_72760 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MAAGKLKKEQQNQSAERESADTGKVNDEDEEHLYGNIDDYKHLIQDEEYDDEDVPHDLQL
SEDEYNSERDSSLLAEFSDYGEISEDDEEDFMNAIREASNFKVKKKKKNDKGKSYGRQRK
ERVLDPEVAQLLSQANEAFVRNDLQVAERLFNEVIKKDARNFAAYETLGDIYQLQGRLND
CCNSWFLAAHLNASDWEFWKIVAILSADLDHVRQAIYCFSRVISLNPMEWESIYRRSMLY
KKTGQLARALDGFQRLYMYNPYDANILRELAILYVDYDRIEDSIELYMKVFNANVERREA
ILAALENALDSSDEESAAEGEDADEKEPLEQDEDRQMFPDINWKKIDAKYKCIPFDWSSL
NILAELFLKLAVSEVDGIKTIKKCARWIQRRESQTFWDHVPDDSEFDNRRFKNSTFDSLL
AAEKEKSYNIPIDIRVRLGLLRLNTDNLVEALNHFQCLYDETFSDVADLYFEAATALTRA
EKYKEAIDFFTPLLSLEEWRTTDVFKPLARCYKEIESYETAKEFYELAIKSEPDDLDIRV
SLAEVYYRLNDPETFKHMLVDVVEMRKHQVDETLHRISNEKSSNDTSDISSKPLLEDSKF
RTFRKKKRTPYDAERERIERERRITAKVVDKYEKMKKFELNSGLNEAKQASIWINTVSEL
VDIFSSVKNFFMKSRSRKFVGILRRTKKFNTELDFQIERLSKLAEGDSVFEGPLMEERVT
LTSATELRGLSYEQWFELFMELSLVIAKYQSVEDGLSVVETAQEVNVFFQDPERVKMMKF
VKLAIVLQMDDEEELAENLRGLLNQFQFNRKVLQVFMYSLCRGPSSLNILSSTIQQKFFL
RQLKAFDSCRYNTEVNGQASITNKEVYNPNKKSSPYLYYIYAVLLYSSRGFLSALQYLTR
LEEDIPDDPMVNLLMGLSHIHRAMQRLTAQRHFQIFHGLRYLYRYHKIRKSLYTDLEKQE
ADYNLGRAFHLIGLVSIAIEYYNRVLENYDDGKLKKHAAYNSIIIYQQSGNVELADHLME
KYLSI
Download sequence
Identical sequences A0A0L8VQJ3 A6ZV34 B5VIZ9 C7GXN2 N1P3U8 P33339
NP_011561.3.97178 YGR047C YGR047C YGR047C YGR047C YGR047C YGR047C YGR047C 4932.YGR047C YGR047C YGR047C tr|A6ZV34|A6ZV34_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]