SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5VKK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5VKK5
Domain Number 1 Region: 465-580
Classification Level Classification E-value
Superfamily PH domain-like 9.25e-17
Family Pleckstrin-homology domain (PH domain) 0.037
Further Details:      
 
Domain Number 2 Region: 261-440
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000356
Family FCH domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B5VKK5
Sequence length 686
Comment (tr|B5VKK5|B5VKK5_YEAS6) YIL105Cp-like protein {ECO:0000313|EMBL:EDZ71539.1} KW=Complete proteome OX=545124 OS=Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast). GN=AWRI1631_90640 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSKNNTMTSAVSDMLSQQQLNLQHLHNLQQHTRSMTSADHANVLQQQQQQQQQQQQQQQQ
QQQSASFQNGSLTSDINQQSYLNGQPVPSTSNSTFQNNRTLTMNSGGLQGIISNGSPNID
SNTNVTIAVPDPNNNNGKQLQGKNSLTNTSILSRARSSLQRQRLAQQQQQQQDPRSPLVI
LVPTAAQPTDILAARFSAWRNVIKSVIVYLTEIASIQDEIVRQQLRLSHAVQFPFFSIEN
QYQPSSQEDKSVQKFFLPLGNGSIQDLPTILNQYHESLASSASKASRELTNDVIPRLEDL
RRDLIVKIKEIKSLQSDFKNSCSKELQQTKQAMKQFQESLKDARYSVPKQDPFLTKLALD
RQIKKQLQEENFLHEAFDNLETSGAELEKIVVMEIQNSLTIYARLLGQEAQLVFDILISK
LDSGFFNVDPQFEWDNFISRDPNFLLPNLPMRTFKEIVYKYQFDPLTYEIKSGFLERRSK
FLKSYSKGYYVLTPNFLHEFKTADRKKDLVPVMSLALSECTVTEHSRKNSTSSPNSTGSD
AKFVLHAKQNGIIRRGHNWVFKADSYESMMSWFDNLKILTSTSNIQDKYKFITQKLNLNS
DGKPKLTNNHTSINKYQLSNANSTMVENDENDDINSNYVGSTVTPKLDNQTNTNTSMSSL
PDTNDSELQDQVPNIYIQTPINDFKS
Download sequence
Identical sequences B3LTV2 B5VKK5 P40485
YIL105C YIL105C YIL105C YIL105C YIL105C YIL105C YIL105C NP_012161.1.97178 YIL105C 4932.YIL105C YIL105C YIL105C SCRT_05278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]