SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5VNM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5VNM6
Domain Number 1 Region: 592-717
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-30
Family Ran-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B5VNM6
Sequence length 720
Comment (tr|B5VNM6|B5VNM6_YEAS6) YLR335Wp-like protein {ECO:0000313|EMBL:EDZ70466.1} KW=Complete proteome OX=545124 OS=Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast). GN=AWRI1631_123630 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MAKRVADAQIQRETYDSNESDDDVTPSTKVASSAVMNRRKIAMPKRRMAFKPFGSAKSDE
TKQASSFSFLNRADGTGEAQVDNSPTTESNSRLKALNLQFKAKVDDLVLSKPLADLRPLF
TRYELYIKNILEAPVKSIENPTQTKGNDAKPAKVEDVQKSSDSSSEDEVKVEGPKFTIDA
KPPISDSVFSFGPKKENRKKDESDSENDIEIKGPEFKFSGTVSSDVFKLNLSTDKNEKKT
ETNAKPFSFSSATSTTEQTKSKNPLSLTEATKTNVDNNSKAEASFTFGTKHAADSQNNKP
SFVFGQAAAKPSLEKSSFTFGSTTIEKKNDENSTSNSKPEKSSDSNDSKPSFSFSIPSKN
TPDASKPSFNFGVPNSSKNETSKPVFSFGAATPSAKEASQEDDNNNVEKPSSKPAFNFIS
NAGTEKEKESKKDSKPAFSFGISNGSESKDSDKPSLPSAVDGENDKKEATKPAFSFGINT
NTTKTADTKAPTFTFGSSALADNKEDVKKPFSFGTSQPNNTPSFSFGKTTANLPANSSTS
PAPSIPSTGFKFSLPFEQKSGQTTTNDSKEESTTEATGNESQDATKVDATPEESKPINLQ
NGEEDEVALFSQKAKLMTFNAETKSYDSRGVGEMKLLKKKDDPSKVRLLCRSDGMGNVLL
NATVVDSFKYEPLAPGNDNLIKAPTVAADGKLVTYIVKFKQKEEGRSFTKAIEDAKKEMK
Download sequence
Identical sequences A0A0L8VL78 B3RHK8 B5VNM6
YLR335W YLR335W YLR335W YLR335W YLR335W SCRT_04281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]