SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5VQI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5VQI2
Domain Number 1 Region: 201-351
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.68e-29
Family Glutathione S-transferase (GST), C-terminal domain 0.0000000559
Further Details:      
 
Domain Number 2 Region: 103-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.33e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B5VQI2
Sequence length 354
Comment (tr|B5VQI2|B5VQI2_YEAS6) Protein URE2 {ECO:0000256|PIRNR:PIRNR037861} KW=Complete proteome OX=545124 OS=Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast). GN=AWRI1631_141020 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MMNNNGNQVSNLSNALRQVNIGNRNSNTTTDQSNINFEFSTGVNNNNNNNSSSNNNNVQN
NNSGRNGSQNNDNENNIKNTLEQHRQQQQAFSDMSHVEYSRITKFFQEQPLEGYTLFSHR
SAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIWE
SGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFRYFHSQK
IASAVERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVW
LVGDKLTIADLAFVPWNNVVDRIGINIKIEFPEVYKWTKHMMRRPAVIKALRGE
Download sequence
Identical sequences A0A0L8VI99 A0A250WGF7 A6ZRL3 B3LP70 B5VQI2 C8ZG05 E7KHF2 E7QJN9 G2WLN6 N1NX06 P23202
YNL229C YNL229C YNL229C NP_014170.1.97178 YNL229C YNL229C 4932.YNL229C YNL229C tr|A6ZRL3|A6ZRL3_YEAS7 YNL229C YNL229C YNL229C SCRT_03354 YNL229C YNL229C YNL229C YNL229C YNL229C YNL229C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]