SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5VQK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5VQK8
Domain Number 1 Region: 304-437,468-498,604-697
Classification Level Classification E-value
Superfamily ARM repeat 0.00000451
Family Armadillo repeat 0.044
Further Details:      
 
Domain Number 2 Region: 29-119
Classification Level Classification E-value
Superfamily PH domain-like 0.0000512
Family Ran-binding domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B5VQK8
Sequence length 858
Comment (tr|B5VQK8|B5VQK8_YEAS6) YNL201Cp-like protein {ECO:0000313|EMBL:EDZ69775.1} KW=Complete proteome OX=545124 OS=Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast). GN=AWRI1631_141300 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSLPGTPTTSPTPMDEDTEQAVSVNTEPKRVKVYILENNEWKDTGTGFCIGEVDEGKFAY
LVVSDEDSPTETLLKSKLEGNIEYQRQEETLIVWKDLGGKDIALSFEESMGCDTLCEFIV
HVQRNIESNISLVTVKSSDNGLGSVHDIITGPVTLPSNDQQQNSQTLLEALKILNENTSF
DFLKNETIEFILQSNYIDTLISHFHKAEEEKIPKDLFLLSNIIKTLILYNQRDILESMVE
DDRIMGIVGILEYDTEYPTSKANHRKYLGSKGPNFKEVIPLENEDLKIIMKKCFRLQFLK
DVVLVRFLDDHNFNLISEIVMDLETCIIDFLQVGTFLDRLIELYDTKTLPESSSEKEKFV
QKRKDGIRLLQQCVQMSINLDAVDRSKFYKTLVRKGLFKVLDYAFHMETDSNVRILATDT
IITIIEHDILLIHNVQNEDSFKRQHKSGPDDKSSHRKYPQDYSSSTDSKLLLILSTILLS
DRSPGLREQVVQALNTLLHPEGCVGNGEGSYDLMGRSNYEAKKTSEDFPSFSYGLNSDSI
NLNNYHYSSDEMNNLEPESESEFQVMEYFANFYNKIAPILFGPLIKKDITTEMAEIDGQI
EKVTKDDLLLIHLVKLVSFVCTEHDRVLSRRFILENGILDSVSKLIGGNHMMQLRLTAVR
CIKNLMCLDDKYYHRYMISKNLYAPVFKLFQENIDKNNLANSCIQDFFRIIITECRAYQN
DGHNRKEKTNGSYDGNGNDVKTNVNNNRTNFTILNKYLVQTYGDVLRKATDIPFIQDMLE
TGEENQPDHSSFENSIEGGNDISVNMSTDGFASNHLEDIDIKNVKRLHSEIEHFENDPHY
SGDQLAFKKSVDQMNAST
Download sequence
Identical sequences A0A0L8VIP1 B3LP47 B5VQK8
YNL201C SCRT_03330 YNL201C YNL201C YNL201C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]