SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5VS26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5VS26
Domain Number 1 Region: 2-42
Classification Level Classification E-value
Superfamily UBA-like 0.000000000952
Family UBA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B5VS26
Sequence length 671
Comment (tr|B5VS26|B5VS26_YEAS6) YOR138Cp-like protein {ECO:0000313|EMBL:EDZ69270.1} KW=Complete proteome OX=545124 OS=Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast). GN=AWRI1631_152920 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENGGSQPRI
FENKIVAGTKPCNVPNNGDQDIEMPDVSGVDVDYDDDEDITDERSGSNSTSGCRVTAQDY
DRYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLAAVYFPHV
FLKPDFKDLNYRADWFKSSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLWQL
QKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPG
IRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEE
DVIRGGEQEEARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYPQLYTK
QCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYLQTIPDDANNE
AAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYILT
MAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETPLMFI
YCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTLRSQFFDGMGDPEQATNNINNGND
NDNDDDIDSDN
Download sequence
Identical sequences B5VS26
YOR138C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]