SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5VSG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5VSG1
Domain Number 1 Region: 6-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.28e-24
Family Phosducin 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B5VSG1
Sequence length 217
Comment (tr|B5VSG1|B5VSG1_YEAS6) YOR281Cp-like protein {ECO:0000313|EMBL:EDZ69138.1} KW=Complete proteome OX=545124 OS=Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast). GN=AWRI1631_154290 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MKMKIFLEAYKIKRLNEIRKLQERSKFGEVFHINKPEYNKEVTLASQGKKYEGTQTNDNG
EEDEGGVYVFVHLSLQSKLQSRVLSHLFQSAACKFREIKFVEIPANRAIENYPESNCPTL
IVYYRGEVIKNMITLLELGGNNSKMEDFEDFMVKVGAVAEGDNRLIMNRDDEESREERKL
HYGEKKSIRSGIRGKFNVGIGGNDDGNINDDDDGFFD
Download sequence
Identical sequences B5VSG1
YOR281C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]