SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5W9B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5W9B0
Domain Number 1 Region: 4-238
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.06e-49
Family Biotin biosynthesis protein BioH 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B5W9B0
Sequence length 247
Comment (tr|B5W9B0|B5W9B0_ARTMA) Alpha/beta hydrolase fold protein {ECO:0000313|EMBL:EDZ91887.1} KW=Complete proteome OX=513049 OS=Arthrospira maxima CS-328. GN=AmaxDRAFT_5360 OC=Microcoleaceae; Arthrospira.
Sequence
MSVFTDHLSQNYQTIAPDLRGYGKSQVKQPFEMTDHLQDIEQLLDSLKIDKCLIIGWSLG
GILALELALTNPERFTGLILVATSAYPRGNHPPISWLDNLLTGIAGIINWIWPASQWNIN
LFGKRSLFRYLIQQHTATAYKYIAKQATPAYLQTSRPATIALRQALKNRYNRLAELGNIS
CHCLILAGECDRHITAISSQETAANLPNSQFNCYPNTAHLFPWEIPDQVITDIDNWIKNH
PDIVDIW
Download sequence
Identical sequences B5W9B0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]