SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6AFJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6AFJ5
Domain Number 1 Region: 104-339
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.27e-55
Family RecA protein-like (ATPase-domain) 0.00000021
Further Details:      
 
Domain Number 2 Region: 23-83
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000000000000118
Family DNA repair protein Rad51, N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B6AFJ5
Sequence length 342
Comment (tr|B6AFJ5|B6AFJ5_CRYMR) Meiotic recombination protein DMC1-like protein, putative {ECO:0000313|EMBL:EEA06986.1} KW=Complete proteome; Reference proteome OX=441375 OS=Cryptosporidium muris (strain RN66). GN=CMU_033710 OC=Eucoccidiorida; Eimeriorina; Cryptosporidiidae; Cryptosporidium.
Sequence
MSSFCQSKSVAKQVLANVNNDDVYVEIEKLQSAGINVAEINKLKAAGLCTVLSIIQATKK
ELCNIKGLSEAKVEKIVEAAQKLEQVSSFQTGTEVLAKRQNILRITTGSEQFDKMLLGGF
ESMCITEIFGENRCGKTQICHTLCVTAQLPTEMSGANGKVCFIDTEGTFRPERIAKISER
FGLQGDVTLDNILYARAYTHEHLNQLISAAAGKMIEERFALLIVDSIIALFRTEFSGRGE
LAERQQILNKTLSKLNKLADQFNIAVVMTNHVMADPAGGMTFMPNIAKPVGGHIIGHASH
VRLSLRKGKGEQRVCKVYGSPHLPESECVIQLSDGGIIDPSD
Download sequence
Identical sequences B6AFJ5
gi|209556941|gb|EEA06986.1| gi|209879790|ref|XP_002141335.1| gb|CMU_033710 XP_002141335.1.43237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]