SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6ES87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6ES87
Domain Number 1 Region: 580-1042
Classification Level Classification E-value
Superfamily ALDH-like 6.41e-117
Family ALDH-like 0.00000108
Further Details:      
 
Domain Number 2 Region: 190-531
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.8e-110
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000499
Further Details:      
 
Domain Number 3 Region: 17-189
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 6.8e-64
Family N-terminal domain of bifunctional PutA protein 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B6ES87
Sequence length 1052
Comment (tr|B6ES87|B6ES87_ALISL) L-glutamate gamma-semialdehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR000197} KW=Complete proteome OX=316275 OS=LFI1238)). GN=VSAL_II0819 OC=Vibrionaceae; Aliivibrio.
Sequence
MFQAKDVLLSSIIDQPLSVLWSAISPLYMVDEAKWIQELIPLAQPTADEAVLMSEQAGDL
IQRVRDDKQAVQMIDALLLEYSLDTKEGILLMCLAEALMRIPDAATADALIRDKLSTADW
KSHLKNSDSTFVNASTWGLLLTGKVVSMDVKSDGSPSNAISRLVNKFSEPVIRQAMNQAM
KIMGHQFVLGRTIEEAQKKGKSMREKGYTYSFDMLGEAALTQSDAHKYFKDYIMAIESVG
RGASIANSADPTVSIKLSALHPRYEMANKERVMGEMCDSVLQLLERARELDVGITIDAEE
ADRLELSLALFEKLYRHDIVKGWGKFGIVVQAYSKRALPVLVWLTALAKEQGDMIPLRLV
KGAYWDTELKISQQFGFARYPVFTRKESTDVSYLACARYLLSDHVKGNIFPQFASHNAHT
VAAIASMATHDEFEYQRLHGMGDALYEHAMAMFQRSVRIYAPVGSHKDLLPYLVRRLLEN
GANSSFVHRLVDASCPIESLTEHPVDTLLACPSFENQLIPLPPHIFSDRKNSYSINFDVE
SEAEPFEALVKEKMDNYWKGGPIVNNSCNYESMIKESVSDLHVITSPYDRSNEVGSLVWS
SQESVSNALEMAHDYFPTWQATSVTERADYLDRLADKLEENMPELVALCHKEAGKTIHDS
IDEVREAVDFCRYYAVQAKLNFSNPETIVGFDDISHQIARQGRGVFVCISPWNFPLAIFL
GQVTAALVAGNTVVAKPAEQTSLIAVRAIELLLETGIAPQAIHLLPGDGKTVGAPLTSDH
RVAGVAFTGSTETAQLINRTLSNRTFEGKGVAPVPFIAETGGQNAMIVDSTALPEQVVRD
VVRSAFSSAGQRCSALRVLFVQEDIAERILNLIKGTMAELSVGLPELHSTDVGPVIDTKA
KEKLLAHIERMTKEGKLLAQATLPEWAEKGDFVPPSAFEIDSISQLENEQFGPILHIVRF
KASELDTMVDDINATGFGLTMGIHSRNEVTYTRIEKNIKVGNCYINRDQVGAVVGVQAFG
GQGLSGTGPKAGGPRYLFRYTQAIASNSVSTK
Download sequence
Identical sequences B6ES87
WP_012552100.1.35969 gi|209809586|ref|YP_002265125.1| 316275.VSAL_II0819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]