SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6JZ51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6JZ51
Domain Number 1 Region: 11-240
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.79e-82
Family Inorganic pyrophosphatase 0.000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B6JZ51
Sequence length 279
Comment (tr|B6JZ51|B6JZ51_SCHJY) Inorganic diphosphatase {ECO:0000313|EMBL:EEB06819.1} KW=Complete proteome; Reference proteome OX=402676 OS=yeast). GN=SJAG_01875 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MSNLARSLFKYQLKAIGRLHTPEFRVYCMKEGKPVSYLHDVPIASDEKTFNMIVEIPRWT
QAKCEIAIHDPLQPIRYDMKNDKIRYVPNCFPFHGYIWNYGVFPQSWENQKERDQFTGLV
GDGDPLDVCDIGGSKGKTGQIKQVKLLGALALIDQGETDWKIIVIDTQDPLAEKMNDIQD
AKRYMPGLLESTKKWFSIYKVPDGKPKNHFALNGQFLNQADTLQLVKRCHESWRTSKLRQ
ERVSERNEQATKDLAQSIIKAPETFMPDFNYPSQPYCYV
Download sequence
Identical sequences B6JZ51
XP_002173112.1.46972 SJAG_01875T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]