SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6K099 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6K099
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.52e-27
Family Thioltransferase 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B6K099
Sequence length 99
Comment (tr|B6K099|B6K099_SCHJY) Glutaredoxin Grx1 {ECO:0000313|EMBL:EEB06249.1} KW=Complete proteome; Reference proteome OX=402676 OS=yeast). GN=SJAG_01292 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MSAVKEFVDSAVEENDVLVFSKTYCPYCSATKKTLKDEGANAKVYELDTMDDGDEIQSYL
ATKTGQRTVPNIFIHKKHIGGNSDLQAIKSKGQLKDLLA
Download sequence
Identical sequences B6K099
SJAG_01292T0 XP_002172542.1.46972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]