SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6K3I1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6K3I1
Domain Number 1 Region: 1-154
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.47e-28
Family Glutathione peroxidase-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B6K3I1
Sequence length 155
Comment (tr|B6K3I1|B6K3I1_SCHJY) Thioredoxin peroxidase {ECO:0000313|EMBL:EEB08038.1} KW=Complete proteome; Reference proteome OX=402676 OS=yeast). GN=SJAG_03166 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MIALGATLPSVELWENKPNNKVEFPDGKIIIVGVPGAFTPPCSSQVPGYVVAAEDFAAKG
VVGIYIVAVNDVFVTNAWKKNLGFENYENVHFVSDWNGEFTKALGAEFDASGLLGPVRSK
RYALVAENKKVQKIYVEGVVTDVDVSSAQNVLEEL
Download sequence
Identical sequences B6K3I1
XP_002174331.1.46972 SJAG_03166T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]